Tudor down?
A blog featuring articles about Tudor watches, sustainability initiatives, and partnerships with celebrities.
Recent User Report Trends for Tudor
Aggregated reports in the last 48 hours.
User Reports for Tudor
Recent issues reported by users from around the world (last 30 days).
About Tudor & Technical Insights
The website targets individuals interested in luxury watches, sports, and related events.
Technologies Used & Relationships
Website Details & Offering
Primary Call to Action
Read all articles
Advertisements Present?
Low
Allows User Accounts?
No
Headquarters Country
Switzerland
Language
English
Primary Category
Blogging
Revenue Source
Advertising
Value Proposition
Provides news and updates about Tudor watches and events.
Content & Features
Content Freshness Clues
2025Discover more
Highlighted Features
Sustainability programCompetition in Bol d'Or
Tone & Style
FormalInformative
Target Audience Insights
Target Category Focus
Luxury and Watches
Target Country
Global
Audience Expertise Level
Intermediate
Device Type
Desktop, Mobile
Geographic Focus
Global
Tech Skills
High
Trust & Support Signals
Company Info Sections
About Us page
Trust Signals Present
Official Timekeeper of Bol d'Or
Similar Websites
Explore other popular services and websites that are similar to tudorwatch.com.
Related Keywords
These keywords represent common themes, topics, and technologies associated with tudorwatch.com.
luxury watchesswiss watchestudor watchesblack baypelagostudor royaldiving watchessport watchesclassic watcheswatch collectionmetas-certifiedchronographgmt watchesdive watcheswatchmakingcraftsmanshipsustainabilityexplorationinnovationpartnershipsformula onecyclingsurfingdakar rallydavid beckhamjay choue-commerceretailluxury goodshorologytimepieceswatch brandsofficial retailerwatch configuratorwatch tutorialswatch guaranteeswiss luxuryadventure watchesprofessional watches
Additional Domain & Security Details
- Domain Name
- tudorwatch.com
- Registrar
- Key-Systems GmbH
- Registrar IANA ID
- 269
- Registrar Email
- abusereport@key-systems.net
- Registrar Phone
- +49.68949396850
- Registrar Website
- http://www.key-systems.net
- Creation Date
- July 20, 1999
- Expiration Date
- July 20, 2035
- Days Remaining
- 3568 days
- Registry Status
- clientTransferProhibited
- serverDeleteProhibited
- serverTransferProhibited
- serverUpdateProhibited
- Last Checked (Registry)
- October 12, 2025 at 06:28:07 PM UTC