Veilig Thuis down?
Recent User Report Trends for Veilig Thuis
Aggregated reports in the last 48 hours.
User Reports for Veilig Thuis
Recent issues reported by users from around the world (last 30 days).
About Veilig Thuis & Technical Insights
The website explicitly states it is for everyone dealing with domestic violence, child abuse, or elder abuse, regardless of age or gender, with specific sections for under/over 18.
Technologies Used
Website Details & Offering
Primary Call to Action
Call 0800-2000
Secondary Calls to Action
Chat with a professionalVisit ikvermoedhuiselijkgeweld.nlContact Kindertelefoon
Advertisements Present?
None
Allows User Accounts?
No
Pricing Summary
Free
Value Proposition
Provides free, confidential advice, support, and reporting for domestic violence, child abuse, and elder abuse, helping individuals take the first step to safety.
Content & Features
Content Freshness Clues
Recent campaign mentionsCurrent contact details (0800-2000)References to active website (ikvermoedhuiselijkgeweld.nl)
Highlighted Features
Confidential adviceAnonymous reportingProfessional listeningSupport for all agesFree service
Tone & Style
SupportiveInformalEmpatheticClearReassuring
Target Audience Insights
Audience Expertise Level
General Public
Target Age Range
All
Gender Focus
All
Geographic Focus
Netherlands
Trust & Support Signals
Company Info Sections
Service descriptionContact detailsProcess explanation
Support Channels Mentioned
PhoneChatKindertelefoon referral
Trust Signals Present
Free serviceAnonymous optionProfessional supportClear contact infoGovernment affiliation (implied)
Similar Websites
Explore other popular services and websites that are similar to veiligthuis.nl.
childhelp.orgrainn.orgncadv.orgthehotline.orgstopitnow.orgwomensaid.org.ukrefuge.org.uknspcc.org.ukchildline.org.uksamaritans.orgmind.org.ukcrisistextline.org211.orghelpguide.orgmentalhealth.govwho.intunicef.orgsave.orgafsp.org
Related Keywords
These keywords represent common themes, topics, and technologies associated with veiligthuis.nl.
veilig thuishuiselijk geweldkindermishandelingadviespuntmeldpuntouderenmishandelingveiligheidhulpverleningsociale dienstcrisisinterventiefamiliegeweldgeweldpreventieveilig thuis flevolandveilig thuis amsterdamveilig thuis utrechtgratis hulplijnanoniem adviesprofessionele hulpzorgen besprekenonveilige thuissituatiesocial workwelfare servicescounselingsupport servicesdomestic violencechild abuseelder abusehelplineemergency servicescommunity supportmental healthfamily servicescrisis supportabuse preventionsocial servicesvictim supportintervention servicessafety netcare services
Additional Domain & Security Details
- Domain Name
- veiligthuis.nl
- Registrar
- Registrar.eu
- Creation Date
- January 23, 2004
- Registry Status
- active
- Last Checked (Registry)
- November 9, 2025 at 08:30:29 PM UTC